!!SEQUENCE_LIST 1.0 BLASTP 2.2.1 [Apr-13-2001] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= /v0/people/staji002/test.gcg (146 letters) Database: pir 274,514 sequences; 93,460,074 total letters Searching. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .done Score E Sequences producing significant alignments: (bits) Value .. PIR2:S44629 Begin: 342 End: 470 !F22B7.10 protein - Caenorhabditis elegans 57 2e-08 PIR2:T21398 Begin: 40 End: 108 !hypothetical protein F26D2.1 - Caenorhabditis elegans 33 0.40 PIR1:WMBELM Begin: 307 End: 385 !membrane protein LMP-2A - human herpesvirus 4 32 0.53 \\End of List >PIR2:S44629 F22B7.10 protein - Caenorhabditis elegans Length = 628 Score = 57.0 bits (136), Expect = 2e-08 Identities = 38/135 (28%), Positives = 69/135 (50%), Gaps = 8/135 (5%) Query: 3 CAAEFDFMEKETPLRYTKTXXXXXXXXXXXXXXRKIISDMWGVLAKQQTHVRKHQFDHGE 62 C+AEFDF++ T + T + + +L + + ++GE Sbjct: 342 CSAEFDFIQYSTIEKLCGTLLIPLALISLVTFVFNFVKNT-NLLWRNSEEIG----ENGE 396 Query: 63 LVYHALQLLAYTALGILIMRLKLFLTPYMCVMASLICSRQLFGW--LFCKVHPGAIVFVI 120 ++Y+ +QL T + LIMRLKLF+TP++C++A+L + +L G + + A+V VI Sbjct: 397 ILYNVVQLCCSTVMAFLIMRLKLFMTPHLCIVAALFANSKLLGGDRISKTIRVSALVGVI 456 Query: 121 LAAMSIQGSANLQTQ 135 A + +G N++ Q Sbjct: 457 -AILFYRGIPNIRQQ 470 >PIR2:T21398 hypothetical protein F26D2.1 - Caenorhabditis elegans Length = 346 Score = 32.7 bits (73), Expect = 0.40 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 11/71 (15%) Query: 66 HALQLLAYTALGILIMRLKLFLTPYMCV---------MASLICSRQLFGWLFCKVHPGAI 116 + + ++A+ +LGI+ L++F+ PY+ V +++ I ++ L WLF + G + Sbjct: 40 YRIMIVAFASLGIIYSGLEVFIKPYLHVYNNCILYFSLSTWISAKPLLPWLFA-IWSG-M 97 Query: 117 VFVILAAMSIQ 127 V++A +SIQ Sbjct: 98 YLVVIAFISIQ 108 >PIR1:WMBELM membrane protein LMP-2A - human herpesvirus 4 Length = 497 Score = 32.3 bits (72), Expect = 0.53 Identities = 26/79 (32%), Positives = 38/79 (47%), Gaps = 4/79 (5%) Query: 67 ALQLLAYTALGILIMRLKLFLTPYMCVMASLICSR----QLFGWLFCKVHPGAIVFVILA 122 AL LLA LG L + L ++ LICS L L ++ A+ ++LA Sbjct: 307 ALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLA 366 Query: 123 AMSIQGSANLQTQWKSTAS 141 + I G + LQT +KS +S Sbjct: 367 SALIAGGSILQTNFKSLSS 385 Database: pir Posted date: Jan 3, 2002 1:13 PM Number of letters in database: 93,460,074 Number of sequences in database: 274,514 Lambda K H 0.329 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,034,208 Number of Sequences: 274514 Number of extensions: 620007 Number of successful extensions: 1381 Number of sequences better than 1.0: 3 Number of HSP's better than 1.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1379 Number of HSP's gapped (non-prelim): 3 length of query: 146 length of database: 93,460,074 effective HSP length: 102 effective length of query: 44 effective length of database: 65,459,646 effective search space: 2880224424 effective search space used: 2880224424 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 70 (31.6 bits)