BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038724|dbj|BAB12759.1| DNA-binding protein hu-alpha [Buchnera sp. APS] (92 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.310 0.127 0.323 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99 Number of Sequences: 1 Number of extensions: 4 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 92 length of database: 607 effective HSP length: 24 effective length of query: 68 effective length of database: 583 effective search space: 39644 effective search space used: 39644 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 156 (65.2 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038744|dbj|BAB12779.1| DNA primase [Buchnera sp. APS] (577 letters) Database: mycge 1 sequences; 607 total letters Searchingdone Score E Sequences producing significant alignments: (bits) Value gi|12045104|ref|NP_072915.1| DNA primase (dnaE) [Mycoplasma gen... 125 7e-33 >gi|12045104|ref|NP_072915.1| DNA primase (dnaE) [Mycoplasma genitalium] Length = 607 Score = 125 bits (310), Expect = 7e-33 Identities = 118/461 (25%), Positives = 222/461 (47%), Gaps = 57/461 (12%) Query: 10 ITELLSRTNIIELI-NTRLELKKYGKNYQTNCPFHHDKTPSFTVSNEKQFYYCFGCNAHG 68 + ELL + I E+I + ++++ G + CPFH DK PS ++S+ K + C+ CNA G Sbjct: 8 LDELLKQIKITEIIQHYGVKIQTKGNSLLALCPFHDDKNPSMSISSSKNIFKCWACNAAG 67 Query: 69 NAIDFLIQYEHLSFIESIEELALIHGVKIPFENTVQNSIYVKKQKLYLLMEKICKLY--- 125 N I F+ +++ L + ++++ I G+K+ N+ + KQK Y + Y Sbjct: 68 NGIAFIQKHDQLDWKTALKKAIEICGIKLENWNSNLLTKVDPKQKRYWEINNALITYYQT 127 Query: 126 --KKNINVTHLANKYLARRGINQNMIDFFLIGFSSLKWNEFYKKINISKEFEQELLINNI 183 K+ N + N + +R +N+ +I+ F +G + +++ + + E+ IN Sbjct: 128 RLKRETNPNGM-NYLVEKRKLNKTLIEQFQLGLAFHNEDKY-----LCESMERYPFINPK 181 Query: 184 I---------ATDKNGY-IYD------RFQGRIIFPIQDNHGRIIGFGGRSLNDMSP-KY 226 I T++ G +D FQ +I+ PI D +G +GF RS+++++ KY Sbjct: 182 IKPSELYLFSKTNQQGLGFFDFNTKKATFQNQIMIPIHDFNGNPVGFSARSVDNINKLKY 241 Query: 227 LNSPETDIFYKRKQIYGLYQVIKKCSKPVYLLVVEGYIDVITLTQYNIDYAVSILGTSTT 286 NS + + F K + ++ +++ K ++ L +VEGY DV TLT + AV+++G + Sbjct: 242 KNSADHEFFKKGELLFNFHRLNKNLNQ---LFIVEGYFDVFTLTNSKFE-AVALMGLALN 297 Query: 287 TEHIQLL---FKNTDIIICCYDGDDAGKNAAWKTLKKALPYISDKKTLKFILL--PNQED 341 I+ + FK ++ D D +G+NA + ++K +++ + I+ N +D Sbjct: 298 DVQIKAIKAHFKELQTLVLALDNDASGQNAVFSLIEK----LNNNNFIVEIVQWEHNYKD 353 Query: 342 PDTIIRKEGREKF----QKRIDNAITMSKFFFKNILKNINLSSDDDKFHLSVHALPLINT 397 D + +G E+ KR + + FF K L +++ F L T Sbjct: 354 WDELYLNKGSEQVILQANKRQNLIEYLVSFFKKQQLDQRVITNKIIAF------LTKNQT 407 Query: 398 ISSD-TIRIYLRQILARMIGILDDNQFEKFLYEKETKNTQK 437 I +D + I+L + L +++ D EK LYE K+ +K Sbjct: 408 ILNDHSFLIFLIKNLVKLLEYSD----EKTLYETVLKHKEK 444 Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.322 0.140 0.406 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 932 Number of Sequences: 1 Number of extensions: 63 Number of successful extensions: 4 Number of sequences better than 1.0e-15: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 577 length of database: 607 effective HSP length: 24 effective length of query: 553 effective length of database: 583 effective search space: 322399 effective search space used: 322399 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 164 (68.3 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038814|dbj|BAB12849.1| integration host factor alpha-subunit [Buchnera sp. APS] (102 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.321 0.138 0.372 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101 Number of Sequences: 1 Number of extensions: 4 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 102 length of database: 607 effective HSP length: 21 effective length of query: 81 effective length of database: 586 effective search space: 47466 effective search space used: 47466 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 157 (65.6 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038947|dbj|BAB12982.1| DNA-binding protein H-ns [Buchnera sp. APS] (135 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.319 0.137 0.390 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 132 Number of Sequences: 1 Number of extensions: 3 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 135 length of database: 607 effective HSP length: 23 effective length of query: 112 effective length of database: 584 effective search space: 65408 effective search space used: 65408 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038982|dbj|BAB13017.1| integration host factor beta-subunit [Buchnera sp. APS] (94 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.319 0.136 0.372 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 114 Number of Sequences: 1 Number of extensions: 6 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 94 length of database: 607 effective HSP length: 21 effective length of query: 73 effective length of database: 586 effective search space: 42778 effective search space used: 42778 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 157 (65.6 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10038996|dbj|BAB13030.1| cold shock-like protein cspC [Buchnera sp. APS] (69 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.316 0.136 0.399 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100 Number of Sequences: 1 Number of extensions: 5 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 69 length of database: 607 effective HSP length: 20 effective length of query: 49 effective length of database: 587 effective search space: 28763 effective search space used: 28763 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 155 (64.8 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10039073|dbj|BAB13107.1| carbon storage regulator [Buchnera sp. APS] (57 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.318 0.138 0.362 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64 Number of Sequences: 1 Number of extensions: 2 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 57 length of database: 607 effective HSP length: 22 effective length of query: 35 effective length of database: 585 effective search space: 20475 effective search space used: 20475 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 154 (64.4 bits) BLASTP 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10039151|dbj|BAB13185.1| cold shock-like protein cspE [Buchnera sp. APS] (69 letters) Database: mycge 1 sequences; 607 total letters Searchingdone ***** No hits found ****** Database: mycge Posted date: May 8, 2001 3:12 PM Number of letters in database: 607 Number of sequences in database: 1 Lambda K H 0.313 0.132 0.375 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80 Number of Sequences: 1 Number of extensions: 2 Number of successful extensions: 0 Number of sequences better than 1.0e-15: 0 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 69 length of database: 607 effective HSP length: 21 effective length of query: 48 effective length of database: 586 effective search space: 28128 effective search space used: 28128 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 155 (64.8 bits)