TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CYS1_DICDI (343 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|L13391_HSAL003871 (Alu-J) 23 0.64 gnl|alu|M30798_HSAL001637 (Alu-J) 20 5.6 gnl|alu|M64231_HSAL003023 (Alu-Sb) 20 5.6 gnl|alu|Y00326_HSAL000959 (Alu-J) 19 9.5 gnl|alu|X69908_HSAL000290 (Alu-J) 19 9.5 gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.5 gnl|alu|M80812_HSAL001801 (Alu-J) 19 9.5 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 23.1 bits (48), Expect = 0.64 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 137 GQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQ 168 G CGSCW + QHF ++ LS + Sbjct: 19 GYCGSCW--------KSQHFGRLRQVEGLSSE 90 >gnl|alu|M30798_HSAL001637 (Alu-J) Length = 331 Score = 20.0 bits (40), Expect = 5.6 Identities = 6/7 (85%), Positives = 7/7 (99%) Frame = +3 Query: 278 PCNPNSL 284 PCNPN+L Sbjct: 12 PCNPNTL 32 >gnl|alu|M64231_HSAL003023 (Alu-Sb) Length = 257 Score = 20.0 bits (40), Expect = 5.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 294 SAKNTIFRKNMPYW 307 S KNT +KN P W Sbjct: 72 STKNTKKKKNGPAW 113 >gnl|alu|Y00326_HSAL000959 (Alu-J) Length = 260 Score = 19.2 bits (38), Expect = 9.5 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -2 Query: 177 CMEYEGEEAC 186 C EY GE C Sbjct: 34 CWEYRGEPPC 5 >gnl|alu|X69908_HSAL000290 (Alu-J) Length = 292 Score = 19.2 bits (38), Expect = 9.5 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = -1 Query: 118 IPTAFDWRTRGAVTPVK---NQGQCGSCWS 144 +P +WR ++ P Q C S WS Sbjct: 256 LPILDNWRDHSSLKPPAPGFKQSSCLSFWS 167 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 19.2 bits (38), Expect = 9.5 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = -1 Query: 137 GQCGSCW 143 G C SCW Sbjct: 115 GACSSCW 95 >gnl|alu|M80812_HSAL001801 (Alu-J) Length = 202 Score = 19.2 bits (38), Expect = 9.5 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = +2 Query: 168 QNLVDCDHEC 177 + +V CDH C Sbjct: 113 ETIVHCDHTC 142 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.316 0.135 0.414 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35241 Number of Sequences: 327 Number of extensions: 483 Number of successful extensions: 7 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 7 length of query: 343 length of database: 26,835 effective HSP length: 31 effective length of query: 312 effective length of database: 16,698 effective search space: 5209776 effective search space used: 5209776 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.3 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ALEU_HORVU (362 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|L13391_HSAL003871 (Alu-J) 23 0.51 gnl|alu|M59213_HSAL001809 (Alu-J) 20 7.5 gnl|alu|M19889_HSAL002725 (Alu-J) 19 9.9 gnl|alu|X05322_HSAL000874 (Alu-Sx) 19 9.9 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 23.5 bits (49), Expect = 0.51 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 164 HCGSCWTFSTTGAL---EAAYTQATGKNISLSEQQLVDCA 200 +CGSCW G L E ++ G +I ++ DCA Sbjct: 22 YCGSCWKSQHFGRLRQVEGLSSEVRGSSIQVTVS--YDCA 135 >gnl|alu|M59213_HSAL001809 (Alu-J) Length = 339 Score = 19.6 bits (39), Expect = 7.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 164 HCGSCWTFSTTG 175 HCGSC F G Sbjct: 8 HCGSCL*FQQFG 43 >gnl|alu|M19889_HSAL002725 (Alu-J) Length = 183 Score = 19.2 bits (38), Expect = 9.9 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -1 Query: 236 GVNGVCHY 243 G NG+CH+ Sbjct: 54 GTNGMCHH 31 >gnl|alu|X05322_HSAL000874 (Alu-Sx) Length = 225 Score = 19.2 bits (38), Expect = 9.9 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 237 VNGVCHYKAEN 247 + GVCHY N Sbjct: 163 ITGVCHYAQLN 131 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.318 0.132 0.400 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31527 Number of Sequences: 327 Number of extensions: 291 Number of successful extensions: 6 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 4 length of query: 362 length of database: 26,835 effective HSP length: 32 effective length of query: 330 effective length of database: 16,371 effective search space: 5402430 effective search space used: 5402430 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.4 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CATH_HUMAN (335 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|M63796_HSAL002417 (Alu-J) 23 0.85 gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 gnl|alu|M65235_HSAL002711 (Alu-Sx) 21 2.5 gnl|alu|M88005_HSAL001281 (Alu-Sx) 21 3.3 gnl|alu|M64231_HSAL003024 (Alu-J) 20 4.3 >gnl|alu|M63796_HSAL002417 (Alu-J) Length = 322 Score = 22.7 bits (47), Expect = 0.85 Identities = 11/34 (32%), Positives = 15/34 (43%) Frame = +1 Query: 302 SWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV 335 SW P W + KN G+ A Y +P+V Sbjct: 76 SWRPAWASGHLIFTKNKKN*LGMVV*ACY-VPVV 174 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 22.3 bits (46), Expect = 1.1 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +1 Query: 136 GACGSCWTFSTTGALESAIAIAT 158 G CGSCW G L +++ Sbjct: 19 GYCGSCWKSQHFGRLRQVEGLSS 87 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 21.2 bits (43), Expect = 2.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -1 Query: 136 GACGSCW 142 GAC SCW Sbjct: 115 GACSSCW 95 >gnl|alu|M88005_HSAL001281 (Alu-Sx) Length = 225 Score = 20.8 bits (42), Expect = 3.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 118 PSVDWRKKGNFVSPVKNQGACGSCWTFST 146 P++ NFV VKN+ +C W+ ++ Sbjct: 165 PTIPNASLTNFVFFVKNRVSCWPGWSLNS 79 >gnl|alu|M64231_HSAL003024 (Alu-J) Length = 287 Score = 20.4 bits (41), Expect = 4.3 Identities = 10/24 (41%), Positives = 13/24 (53%) Frame = -2 Query: 96 WSEPQNCSATKSNYLRGTGPYPPS 119 WS + A + LRG+G PPS Sbjct: 232 WSAVASIMAHYTLGLRGSGDPPPS 161 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.319 0.134 0.436 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44068 Number of Sequences: 327 Number of extensions: 498 Number of successful extensions: 7 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 335 length of database: 26,835 effective HSP length: 29 effective length of query: 306 effective length of database: 17,352 effective search space: 5309712 effective search space used: 5309712 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.5 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CATH_RAT (333 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|L13391_HSAL003871 (Alu-J) 24 0.36 gnl|alu|M65235_HSAL002711 (Alu-Sx) 21 2.4 gnl|alu|L11016_HSAL003845 (Alu-J) 19 9.2 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 23.9 bits (50), Expect = 0.36 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 134 GACGSCWTFSTTGALESAVAIAS 156 G CGSCW G L ++S Sbjct: 19 GYCGSCWKSQHFGRLRQVEGLSS 87 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 21.2 bits (43), Expect = 2.4 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -1 Query: 134 GACGSCW 140 GAC SCW Sbjct: 115 GACSSCW 95 >gnl|alu|L11016_HSAL003845 (Alu-J) Length = 197 Score = 19.2 bits (38), Expect = 9.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 124 GNVVSPVKNQGACGS 138 GN+V P + +CGS Sbjct: 93 GNIVRPHFYKASCGS 137 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.319 0.131 0.412 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35152 Number of Sequences: 327 Number of extensions: 361 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 333 length of database: 26,835 effective HSP length: 31 effective length of query: 302 effective length of database: 16,698 effective search space: 5042796 effective search space used: 5042796 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 35 (19.0 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CATL_HUMAN (333 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 gnl|alu|M63544_HSAL002045 (Alu-J) 21 3.1 gnl|alu|Z17809_HSAL003365 (Alu-Sx) 20 7.0 gnl|alu|X16277_HSAL000821 (Alu-J) 19 9.2 gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.2 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 22.3 bits (46), Expect = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 133 GQCGSCWAFSATGAL 147 G CGSCW G L Sbjct: 19 GYCGSCWKSQHFGRL 63 >gnl|alu|M63544_HSAL002045 (Alu-J) Length = 265 Score = 20.8 bits (42), Expect = 3.1 Identities = 9/22 (40%), Positives = 14/22 (62%), Gaps = 2/22 (9%) Frame = -2 Query: 260 KEGIYFEP--DCSSEDMDHGVL 279 ++G+ P +CSS MDH +L Sbjct: 252 RQGLALSPRLECSSAIMDHCIL 187 >gnl|alu|Z17809_HSAL003365 (Alu-Sx) Length = 207 Score = 19.6 bits (39), Expect = 7.0 Identities = 6/14 (42%), Positives = 10/14 (70%) Frame = -3 Query: 174 GNEGCNGGLMDYAF 187 G +GC GLM +++ Sbjct: 172 GVQGCGHGLMGFSY 131 >gnl|alu|X16277_HSAL000821 (Alu-J) Length = 287 Score = 19.2 bits (38), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (77%) Frame = +3 Query: 64 QEYREGKHSFTMAM 77 QE+ G+HS T+++ Sbjct: 72 QEFEPGQHSETLSL 113 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 19.2 bits (38), Expect = 9.2 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = -1 Query: 133 GQCGSCW 139 G C SCW Sbjct: 115 GACSSCW 95 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.317 0.133 0.417 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39061 Number of Sequences: 327 Number of extensions: 451 Number of successful extensions: 9 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 333 length of database: 26,835 effective HSP length: 31 effective length of query: 302 effective length of database: 16,698 effective search space: 5042796 effective search space used: 5042796 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.3 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CATL_RAT (334 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|Z17809_HSAL003365 (Alu-Sx) 22 1.4 gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.9 gnl|alu|Z30166_HSAL006097 (Alu-J) 21 2.5 gnl|alu|L26953_HSAL004755 (Alu-Sx) 20 4.2 gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.5 >gnl|alu|Z17809_HSAL003365 (Alu-Sx) Length = 207 Score = 21.9 bits (45), Expect = 1.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 174 GNQGCNGGLMDFAF 187 G QGC GLM F++ Sbjct: 172 GVQGCGHGLMGFSY 131 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 21.6 bits (44), Expect = 1.9 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 133 GQCGSCW 139 G CGSCW Sbjct: 19 GYCGSCW 39 >gnl|alu|Z30166_HSAL006097 (Alu-J) Length = 168 Score = 21.2 bits (43), Expect = 2.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 108 EPLMLQIPKTVDWREKGCVTPV 129 +P L +PK D+R C P+ Sbjct: 77 DPAHLSLPKCWDYRLSHCAWPL 12 >gnl|alu|L26953_HSAL004755 (Alu-Sx) Length = 337 Score = 20.4 bits (41), Expect = 4.2 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +1 Query: 171 HDQGNQGCN 179 HD G +GCN Sbjct: 223 HDPGGRGCN 249 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 19.2 bits (38), Expect = 9.5 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = -1 Query: 133 GQCGSCW 139 G C SCW Sbjct: 115 GACSSCW 95 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.317 0.134 0.426 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36291 Number of Sequences: 327 Number of extensions: 428 Number of successful extensions: 8 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 334 length of database: 26,835 effective HSP length: 30 effective length of query: 304 effective length of database: 17,025 effective search space: 5175600 effective search space used: 5175600 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.4 bits) S2: 38 (19.2 bits) TBLASTN 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAPA_CARPA (345 letters) Database: alu.n 327 sequences; 80,506 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 gnl|alu|X68486_HSAL004968 (Alu-J) 20 5.7 gnl|alu|M65235_HSAL002711 (Alu-Sx) 20 5.7 gnl|alu|M78078_HSAL003530 (Alu-Sc) 19 9.8 gnl|alu|M63322_HSAL001805 (Alu-J) 19 9.8 >gnl|alu|L13391_HSAL003871 (Alu-J) Length = 193 Score = 22.3 bits (46), Expect = 1.1 Identities = 9/21 (42%), Positives = 12/21 (56%), Gaps = 3/21 (14%) Frame = +1 Query: 153 GSCGSCWA---FSAVVTIEGI 170 G CGSCW F + +EG+ Sbjct: 19 GYCGSCWKSQHFGRLRQVEGL 81 >gnl|alu|X68486_HSAL004968 (Alu-J) Length = 249 Score = 20.0 bits (40), Expect = 5.7 Identities = 11/49 (22%), Positives = 20/49 (40%), Gaps = 10/49 (20%) Frame = -2 Query: 14 AICLFVYMGLSFGDFSIVGYS----------QNDLTSTERLIQLFESWM 52 A+CLF++ FG + + N L + + + ESW+ Sbjct: 149 AVCLFIFSFFFFGRNGLFAHVAQAGLALLG*SNPLALASQSLGITESWV 3 >gnl|alu|M65235_HSAL002711 (Alu-Sx) Length = 325 Score = 20.0 bits (40), Expect = 5.7 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = -1 Query: 153 GSCGSCW 159 G+C SCW Sbjct: 115 GACSSCW 95 >gnl|alu|M78078_HSAL003530 (Alu-Sc) Length = 158 Score = 19.2 bits (38), Expect = 9.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 204 ALQLVAQYGIHYRN 217 + LVAQ G+ +RN Sbjct: 104 SFNLVAQAGVQWRN 63 >gnl|alu|M63322_HSAL001805 (Alu-J) Length = 345 Score = 19.2 bits (38), Expect = 9.8 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 73 KDNLKYIDETNKKNN 87 K+ +KY+ + NKK + Sbjct: 284 KNKIKYVFKNNKKKS 328 Database: alu.n Posted date: Feb 26, 2001 4:36 AM Number of letters in database: 80,506 Number of sequences in database: 327 Lambda K H 0.318 0.138 0.428 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33866 Number of Sequences: 327 Number of extensions: 356 Number of successful extensions: 7 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 345 length of database: 26,835 effective HSP length: 30 effective length of query: 315 effective length of database: 17,025 effective search space: 5362875 effective search space used: 5362875 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 36 (19.4 bits) S2: 38 (19.2 bits)